HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A6N3Z5R0",
"id": "A0A6N3Z5R0_ALIFS",
"source_organism": {
"taxId": "668",
"scientificName": "Aliivibrio fischeri",
"fullName": "Aliivibrio fischeri"
},
"name": "L-2,4-diaminobutyric acid acetyltransferase",
"description": [
"Catalyzes the acetylation of L-2,4-diaminobutyrate (DABA) to gamma-N-acetyl-alpha,gamma-diaminobutyric acid (ADABA) with acetyl coenzyme A"
],
"length": 185,
"sequence": "MYLHMAIAAPRILCPDMDSDTTKKWIFREPSRTDGDDVYALITECPPLDINSSYCNFLQATHFSKTCVLAEKDGDLAGFISGYQEPDEPNTLFIWQVAVSPRYRGKGLAFSMLTTLLERKNLLHIEFIETTITKANNASWSLFKKIDAQYGNQGQVTTFLDKESHFKGKHDTEYLYRIPLKSSQK",
"proteome": null,
"gene": "ectA",
"go_terms": [
{
"identifier": "GO:0016747",
"name": "acyltransferase activity, transferring groups other than amino-acyl groups",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0033816",
"name": "diaminobutyrate acetyltransferase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0019491",
"name": "ectoine biosynthetic process",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "b275a6f4148e51878711e7aee687990d48d71c3c",
"counters": {
"domain_architectures": 467067,
"entries": 9,
"isoforms": 0,
"proteomes": 0,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"profile": 1,
"cathgene3d": 1,
"cdd": 1,
"ncbifam": 1,
"pfam": 1,
"interpro": 3
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 467067
}
}
}