HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A6N3R1P1",
"id": "A0A6N3R1P1_SHIFL",
"source_organism": {
"taxId": "754091",
"scientificName": "Shigella flexneri CCH060",
"fullName": "Shigella flexneri CCH060"
},
"name": "Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF",
"description": [
"Translocates 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol (alpha-L-Ara4N-phosphoundecaprenol) from the cytoplasmic to the periplasmic side of the inner membrane"
],
"length": 128,
"sequence": "MGLIWGLFSVIIASVAQLSLGFAASHLPPMTHLWDFIAALLAFGLDARILLLGLLGYLLSVFCWYKTLHKLALSKAYALLSMSYVLVWIASMVLPGWEGTFSLKALLGVACIMSGLMLIFLPTTKQRY",
"proteome": null,
"gene": "arnF",
"go_terms": [
{
"identifier": "GO:1901505",
"name": "carbohydrate derivative transmembrane transporter activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0009103",
"name": "lipopolysaccharide biosynthetic process",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0022857",
"name": "transmembrane transporter activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0016020",
"name": "membrane",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": null,
"counters": {
"domain_architectures": 0,
"entries": 8,
"isoforms": 0,
"proteomes": 0,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"hamap": 1,
"panther": 1,
"ncbifam": 1,
"interpro": 3
},
"proteome": 0,
"taxonomy": 1
}
}
}