General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A6N3D0Q0",
        "id": "A0A6N3D0Q0_ENTAG",
        "source_organism": {
            "taxId": "549",
            "scientificName": "Enterobacter agglomerans",
            "fullName": "Enterobacter agglomerans (Erwinia herbicola)"
        },
        "name": "Outer membrane lipoprotein RcsF",
        "description": [
            "Essential component of the Rcs signaling system, which controls transcription of numerous genes. Plays a role in signal transduction from the cell surface to the histidine kinase RcsC. May detect outer membrane defects"
        ],
        "length": 134,
        "sequence": "MRALPICLLALMLSGCSMLSRSPVEPVQSTATPPKTEPAKPKVVRPAPVRIITKADELVGKPFRELGEVSGESCQATNQDSPPNIPTARKRMQINAAKMKANAVLLHSCEVTSGTPGCYRQAVCIGSALNITAK",
        "proteome": null,
        "gene": "rcsF",
        "go_terms": [
            {
                "identifier": "GO:0035556",
                "name": "intracellular signal transduction",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0009279",
                "name": "cell outer membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "94b0c85247bc0ee322348838df57eb37a9961419",
        "counters": {
            "domain_architectures": 1404,
            "entries": 6,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "profile": 1,
                "cathgene3d": 1,
                "hamap": 1,
                "ncbifam": 1,
                "pfam": 1,
                "interpro": 1
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 1404
        }
    }
}