GET /api/protein/UniProt/A0A6N3CX01/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A6N3CX01",
        "id": "A0A6N3CX01_EUBLI",
        "source_organism": {
            "taxId": "1736",
            "scientificName": "Eubacterium limosum",
            "fullName": "Eubacterium limosum"
        },
        "name": "phosphoenolpyruvate--glycerone phosphotransferase",
        "description": [
            "ADP-binding subunit of the dihydroxyacetone kinase, which is responsible for the phosphoenolpyruvate (PEP)-dependent phosphorylation of dihydroxyacetone. DhaL-ADP is converted to DhaL-ATP via a phosphoryl group transfer from DhaM and transmits it to dihydroxyacetone binds to DhaK"
        ],
        "length": 213,
        "sequence": "MAATKENVLTFIHLFNDKMQEHRQALTDMDQAIGDGDHGINMSRGMKAVEEKLPTFEEKNIDDILKGVGMTLVSTVGGASGPLYGTAFMKAGMTSKGKDELTAEDISAALEAAIEGIKQRGKSTTGEKTMLDAIVPAKEAYDKAVGEGKGIADALADAEAAAWDGVEYTKTIIATKGRASYLGERSIGHQDPGATSITYLIQAAKEAGEQAGA",
        "proteome": null,
        "gene": "dhaL_3",
        "go_terms": [
            {
                "identifier": "GO:0004371",
                "name": "glycerone kinase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006071",
                "name": "glycerol metabolic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0016772",
                "name": "transferase activity, transferring phosphorus-containing groups",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 4,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "baa1b2712165317fd290f43839de0f690ded3584",
        "counters": {
            "domain_architectures": 10228,
            "entries": 11,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "profile": 1,
                "smart": 1,
                "panther": 1,
                "ncbifam": 1,
                "pfam": 1,
                "interpro": 4
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 10228
        }
    }
}