GET /api/protein/UniProt/A0A6N2SRV5/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A6N2SRV5",
        "id": "A0A6N2SRV5_9FIRM",
        "source_organism": {
            "taxId": "105841",
            "scientificName": "Anaerostipes caccae",
            "fullName": "Anaerostipes caccae"
        },
        "name": "Ribosomal silencing factor RsfS",
        "description": [
            "Functions as a ribosomal silencing factor. Interacts with ribosomal protein uL14 (rplN), blocking formation of intersubunit bridge B8. Prevents association of the 30S and 50S ribosomal subunits and the formation of functional ribosomes, thus repressing translation"
        ],
        "length": 117,
        "sequence": "MNQSLEMTKIAYQALEEKLAEEIKVLDIRQISVIADYFIIANGKNKNQVQAIVDNVQDALQKAGYEMKQMEGYQNGTWVLIDFGDIVIHIFDQENRLFYDLERIWKDGVEVSMETGV",
        "proteome": null,
        "gene": "rsfS",
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "d48e6f35bd449e7c5e049b7acf80a935592d4454",
        "counters": {
            "domain_architectures": 26485,
            "entries": 8,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "hamap": 1,
                "panther": 1,
                "ncbifam": 1,
                "pfam": 1,
                "interpro": 2
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 26485
        }
    }
}