HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A6N2QYK6",
"id": "A0A6N2QYK6_9FIRM",
"source_organism": {
"taxId": "536633",
"scientificName": "Blautia glucerasea",
"fullName": "Blautia glucerasea"
},
"name": "Proline--tRNA ligase",
"description": [
"Catalyzes the attachment of proline to tRNA(Pro) in a two-step reaction: proline is first activated by ATP to form Pro-AMP and then transferred to the acceptor end of tRNA(Pro)"
],
"length": 479,
"sequence": "MAKEKKLVEAITSMEEDFAQWYTDVVKKAELCDYTSVKGCMVIKPAGYAIWENIQNELDRRFKETGVQNVYMPMFIPESLLQKEKDHVEGFAPEVAWVTHGGLDPLQERLCVRPTSETLFCDFYQKEIQSHRDLPKVYNQWCSVVRWEKTTRPFLRSREFLWQEGHTAHATAQEAEERTIQMLNVYADFCEEVLAIPVVKGQKTDKEKFAGAEATYTIESLMHDGKALQSGTSHNFGDGFAKAFGIQYTDKENKLQYVHQTSWGMTTRMIGAIIMVHGDNSGLVLPPRIAPVQAVIIPIQQRKEGVLEKADQLFAALKAAGIRVKVDDTDRSPGYKFSEQEMRGIPVRIECGPKDIEKGQAVICRRDTREKYVVSFEELSAKVQEILDTMQKDMLERARAHREEHTYVATDYETFKDTVNNKPGFVKAMWCGDQACEDKIKEDVQATSRCMPFEQEHLSDVCVCCGKPAKKMVYWGRAY",
"proteome": null,
"gene": "proS",
"go_terms": [
{
"identifier": "GO:0000166",
"name": "nucleotide binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0004812",
"name": "aminoacyl-tRNA ligase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0005524",
"name": "ATP binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006418",
"name": "tRNA aminoacylation for protein translation",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0004827",
"name": "proline-tRNA ligase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006433",
"name": "prolyl-tRNA aminoacylation",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0005737",
"name": "cytoplasm",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "6ec8f3ce062572516c3c6871deec34106cc00098",
"counters": {
"domain_architectures": 9732,
"entries": 27,
"isoforms": 0,
"proteomes": 0,
"sets": 4,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 3,
"ssf": 3,
"cdd": 2,
"profile": 1,
"pfam": 3,
"smart": 1,
"panther": 1,
"hamap": 1,
"ncbifam": 1,
"prints": 1,
"interpro": 10
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 9732
}
}
}