HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A6N1VKG7",
"id": "A0A6N1VKG7_9HYPH",
"source_organism": {
"taxId": "2742145",
"scientificName": "Oricola thermophila",
"fullName": "Oricola thermophila"
},
"name": "Heme exporter protein B",
"description": [
"Required for the export of heme to the periplasm for the biogenesis of c-type cytochromes"
],
"length": 221,
"sequence": "MTALILRDIRIGVRAGGGMLIGILFFLAVIAVVPFAVGPDLNLLARIGPAILWIGALLASLLGLDRLFQADREDGSLDLMVMAGHDQPLSLTVFAKCVAHWLTTGLPLVVVSPALGLLMNMEPAAILATSLTLLAGTPAVTFIGATGAALAVALPRGGLLVSVMVLPFVIPVLIFGVMAAYGAVEDPAPFTQPFLLLCALTLFFAALGPLAAGAALKAASD",
"proteome": "UP000509367",
"gene": "ccmB",
"go_terms": [
{
"identifier": "GO:0015232",
"name": "heme transmembrane transporter activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0015886",
"name": "heme transport",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0017004",
"name": "cytochrome complex assembly",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0016020",
"name": "membrane",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "5d79c91875402269d8b838b04eb3b1f899db52da",
"counters": {
"domain_architectures": 11035,
"entries": 7,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"pfam": 1,
"panther": 1,
"pirsf": 1,
"ncbifam": 1,
"prints": 1,
"interpro": 2
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 11035
}
}
}