HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A6N1CGX4",
"id": "A0A6N1CGX4_9PSED",
"source_organism": {
"taxId": "2681983",
"scientificName": "Pseudomonas bijieensis",
"fullName": "Pseudomonas bijieensis"
},
"name": "Aspartate carbamoyltransferase",
"description": [
"Catalyzes the condensation of carbamoyl phosphate and aspartate to form carbamoyl aspartate and inorganic phosphate, the committed step in the de novo pyrimidine nucleotide biosynthesis pathway"
],
"length": 334,
"sequence": "MTPLETKRPLQLNDQGQLRHFLSLDGLRRELLTEILDTADSFLEVGARAVKKVPLLRGKTVCNVFFENSTRTRTTFELAAQRLSADVITLNVSTSSASKGETLLDTLRNLEAMAADMFVVRHGDSGAAHFIAEHVCPQVAIINGGDGRHAHPTQGMLDMLTIRRHKGSFENLSVAIVGDILHSRVARSNMLALKTLGCPDIRVIAPKTLLPIGVEQYGVKVYTDMTEGLKDVDVVIMLRLQRERMTGGLLPSEGEFYRLFGLTTARLAGAKPDAIVMHPGPINRGVEIESAVADGPHSVILNQVTYGIAIRMAVLSMAMSGQTAQRQFDQENAQ",
"proteome": "UP000509545",
"gene": "pyrB",
"go_terms": [
{
"identifier": "GO:0016597",
"name": "amino acid binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0016743",
"name": "carboxyl- or carbamoyltransferase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006520",
"name": "amino acid metabolic process",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0004070",
"name": "aspartate carbamoyltransferase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006207",
"name": "'de novo' pyrimidine nucleobase biosynthetic process",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "bdacf10835f8198fb41f918256523d0ff4cee5f2",
"counters": {
"domain_architectures": 59675,
"entries": 16,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"pfam": 2,
"cathgene3d": 1,
"panther": 1,
"hamap": 1,
"ncbifam": 2,
"prints": 2,
"prosite": 1,
"interpro": 5
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 59675
}
}
}