GET /api/protein/UniProt/A0A6N1CGX4/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A6N1CGX4",
        "id": "A0A6N1CGX4_9PSED",
        "source_organism": {
            "taxId": "2681983",
            "scientificName": "Pseudomonas bijieensis",
            "fullName": "Pseudomonas bijieensis"
        },
        "name": "Aspartate carbamoyltransferase",
        "description": [
            "Catalyzes the condensation of carbamoyl phosphate and aspartate to form carbamoyl aspartate and inorganic phosphate, the committed step in the de novo pyrimidine nucleotide biosynthesis pathway"
        ],
        "length": 334,
        "sequence": "MTPLETKRPLQLNDQGQLRHFLSLDGLRRELLTEILDTADSFLEVGARAVKKVPLLRGKTVCNVFFENSTRTRTTFELAAQRLSADVITLNVSTSSASKGETLLDTLRNLEAMAADMFVVRHGDSGAAHFIAEHVCPQVAIINGGDGRHAHPTQGMLDMLTIRRHKGSFENLSVAIVGDILHSRVARSNMLALKTLGCPDIRVIAPKTLLPIGVEQYGVKVYTDMTEGLKDVDVVIMLRLQRERMTGGLLPSEGEFYRLFGLTTARLAGAKPDAIVMHPGPINRGVEIESAVADGPHSVILNQVTYGIAIRMAVLSMAMSGQTAQRQFDQENAQ",
        "proteome": "UP000509545",
        "gene": "pyrB",
        "go_terms": [
            {
                "identifier": "GO:0016597",
                "name": "amino acid binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0016743",
                "name": "carboxyl- or carbamoyltransferase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006520",
                "name": "amino acid metabolic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0004070",
                "name": "aspartate carbamoyltransferase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006207",
                "name": "'de novo' pyrimidine nucleobase biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "bdacf10835f8198fb41f918256523d0ff4cee5f2",
        "counters": {
            "domain_architectures": 59675,
            "entries": 16,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "pfam": 2,
                "cathgene3d": 1,
                "panther": 1,
                "hamap": 1,
                "ncbifam": 2,
                "prints": 2,
                "prosite": 1,
                "interpro": 5
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 59675
        }
    }
}