General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A6N1CD22",
        "id": "A0A6N1CD22_9PSED",
        "source_organism": {
            "taxId": "2681983",
            "scientificName": "Pseudomonas bijieensis",
            "fullName": "Pseudomonas bijieensis"
        },
        "name": "Peptide methionine sulfoxide reductase MsrB",
        "description": null,
        "length": 130,
        "sequence": "MEKLQKTLEEWRAMLDPEQYNVCRLKGTERPFSGKYNATKTDGVYHCICCNEPLFDSRTKFDSGCGWPSFYAPIEGSAVVEVRDVSHGMIRTEVVCAKCDAHLGHVFPDGPPPTGLRYCINSVCLDLVPR",
        "proteome": "UP000509545",
        "gene": "msrB",
        "go_terms": [
            {
                "identifier": "GO:0033743",
                "name": "peptide-methionine (R)-S-oxide reductase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0016671",
                "name": "oxidoreductase activity, acting on a sulfur group of donors, disulfide as acceptor",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006979",
                "name": "response to oxidative stress",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0030091",
                "name": "protein repair",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "deb4c5e8efd21b1ddf07e78fdbd67304e03e4fcf",
        "counters": {
            "domain_architectures": 33949,
            "entries": 10,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "profile": 1,
                "pfam": 1,
                "panther": 1,
                "ncbifam": 1,
                "hamap": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 33949
        }
    }
}