GET /api/protein/UniProt/A0A6M8UE65/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A6M8UE65",
"id": "A0A6M8UE65_9GAMM",
"source_organism": {
"taxId": "2740817",
"scientificName": "Paramixta manurensis",
"fullName": "Paramixta manurensis"
},
"name": "Xanthine-guanine phosphoribosyltransferase",
"description": [
"Purine salvage pathway enzyme that catalyzes the transfer of the ribosyl-5-phosphate group from 5-phospho-alpha-D-ribose 1-diphosphate (PRPP) to the N9 position of the 6-oxopurines guanine and xanthine to form the corresponding ribonucleotides GMP (guanosine 5'-monophosphate) and XMP (xanthosine 5'-monophosphate), with the release of PPi. To a lesser extent, also acts on hypoxanthine"
],
"length": 152,
"sequence": "MSEKYVVTWDMLQIHARKLAQRLLPVEQWKGIIAVSRGGLVPASLLARELGLRHVDTVCISSYDHDHQREMKVLKRAEGDGEGFIVIDDLVDTGGTAQAIRDMYPKAHFVTIFAKPAGRPLVDDYVVDIPQNTWIEQPWDMGVVYIPPIVKS",
"proteome": "UP000505325",
"gene": "gpt",
"go_terms": [
{
"identifier": "GO:0000310",
"name": "xanthine phosphoribosyltransferase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "0f8ac38f062a402c09070bf5cbec330fb03fbefd",
"counters": {
"domain_architectures": 136430,
"entries": 10,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"pfam": 1,
"cdd": 1,
"panther": 1,
"ncbifam": 1,
"hamap": 1,
"interpro": 3
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 136430
}
}
}