General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A6M8HVN0",
        "id": "A0A6M8HVN0_9PROT",
        "source_organism": {
            "taxId": "1484109",
            "scientificName": "Lichenicola cladoniae",
            "fullName": "Lichenicola cladoniae"
        },
        "name": "Ubiquinol-cytochrome c reductase iron-sulfur subunit",
        "description": [
            "Component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is a respiratory chain that generates an electrochemical potential coupled to ATP synthesis"
        ],
        "length": 209,
        "sequence": "MHDEPGTNAAAEPVRRDFLTLLTVATAAVGACAFAWPFIDSLDGTGSGDAADAVVDIDLTHLAPGQQVETVWRGHPVFVVHRTQDALQALQTSELQRRLRDPVSAEHQQPDYAVNWHRSIVPEYGVMVGVCTHLGCIPRFRPTVDLAAPGGYACPCHGSRFDLAGRVFAGAPAPYNLPVPPHTLVTPTHLRIGVNPDGDHFDFDTIKQI",
        "proteome": "UP000500767",
        "gene": "petA",
        "go_terms": [
            {
                "identifier": "GO:0008121",
                "name": "quinol-cytochrome-c reductase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0051537",
                "name": "2 iron, 2 sulfur cluster binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0016020",
                "name": "membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "6cdb38d7d429b50b6352c44271340451269553a7",
        "counters": {
            "domain_architectures": 6855,
            "entries": 20,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 3,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "profile": 2,
                "cathgene3d": 2,
                "pfam": 2,
                "ncbifam": 2,
                "ssf": 1,
                "cdd": 1,
                "panther": 1,
                "prints": 1,
                "interpro": 8
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 6855
        }
    }
}