General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A6M3ZJP2",
        "id": "A0A6M3ZJP2_BACSU",
        "source_organism": {
            "taxId": "224308",
            "scientificName": "Bacillus subtilis (strain 168)",
            "fullName": "Bacillus subtilis (strain 168)"
        },
        "name": "Ribosome hibernation promoting factor",
        "description": [
            "Required for dimerization of active 70S ribosomes into 100S ribosomes in stationary phase; 100S ribosomes are translationally inactive and sometimes present during exponential growth"
        ],
        "length": 189,
        "sequence": "MNYNIRGENIEVTPALKDHVERKIGKLERYFDHSVDADVNVNLKFYNDKESKVEVTIPMTDLALRSEVHNEDMYNAIDLATNKLERQIRKHKTKVNRKFREQGSPKYLLANGLGSDTDIAVQDDIEEEESLDIVRQKRFNLKPMDSEEAILQMNMLGHNFFVFTNAETNLTNVVYRRNDGKYGLIEPTE",
        "proteome": null,
        "gene": "hpf",
        "go_terms": [
            {
                "identifier": "GO:0044238",
                "name": "primary metabolic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "10b787fd754c69bbea81ae0c717f606b2f3d6e03",
        "counters": {
            "domain_architectures": 13934,
            "entries": 15,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "cdd": 1,
                "ssf": 1,
                "pfam": 2,
                "ncbifam": 1,
                "hamap": 1,
                "panther": 1,
                "interpro": 6
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 13934
        }
    }
}