HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A6M3RIC1",
"id": "A0A6M3RIC1_9CHLO",
"source_organism": {
"taxId": "2607981",
"scientificName": "Micractinium singularis",
"fullName": "Micractinium singularis"
},
"name": "Photosystem II reaction center protein T",
"description": [
"Found at the monomer-monomer interface of the photosystem II (PS II) dimer, plays a role in assembly and dimerization of PSII. PSII is a light-driven water plastoquinone oxidoreductase, using light energy to abstract electrons from H(2)O, generating a proton gradient subsequently used for ATP formation"
],
"length": 31,
"sequence": "MEALVYTFLLVGTLGIIFFSIFFREPPRIVK",
"proteome": null,
"gene": "psbT",
"go_terms": [
{
"identifier": "GO:0015979",
"name": "photosynthesis",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0009523",
"name": "photosystem II",
"category": {
"code": "C",
"name": "cellular_component"
}
},
{
"identifier": "GO:0009539",
"name": "photosystem II reaction center",
"category": {
"code": "C",
"name": "cellular_component"
}
},
{
"identifier": "GO:0016020",
"name": "membrane",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "159706e7ef5b54f14c3f94440dbaf86f3b9e758d",
"counters": {
"domain_architectures": 15714,
"entries": 6,
"isoforms": 0,
"proteomes": 0,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"pfam": 1,
"panther": 1,
"hamap": 1,
"interpro": 2
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 15714
}
}
}