General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A6M1STM9",
        "id": "A0A6M1STM9_9BACT",
        "source_organism": {
            "taxId": "2709311",
            "scientificName": "Halalkalibaculum roseum",
            "fullName": "Halalkalibaculum roseum"
        },
        "name": "HPr kinase/phosphorylase",
        "description": [
            "Catalyzes the ATP- as well as the pyrophosphate-dependent phosphorylation of a specific serine residue in HPr, a phosphocarrier protein of the phosphoenolpyruvate-dependent sugar phosphotransferase system (PTS). HprK/P also catalyzes the pyrophosphate-producing, inorganic phosphate-dependent dephosphorylation (phosphorolysis) of seryl-phosphorylated HPr (P-Ser-HPr)"
        ],
        "length": 342,
        "sequence": "MPFGNHEPIPKKKEISVSYLVEKVQEQVHIELEACVAEDCCDDRSVTEADLHRPGLALAGYIELFTHQRIQVIGNTESRYLEYLSREKQKEAFANIVQFNLPVIFLTDSNKLPVYLLDMAKKEGIPVFRTPVETTQFMALIRDFLEDQFALQTMVHGSMVDVYGIGILIAGKSGIGKSEVALDLVERGHRLVADDVVMLTKKHNVLMTSASEMNKHFMEIRGLGIIDIMSMFGIRAIRYQKRLEIVLELSLWDESEDIERTGLNRDKTSVLGVDIPLINLPITPGKNITVIAEVIAMNYLLRHYGYDAAEAFQEKVKKSIATKKGEGNIPTRAVEYFEGDIE",
        "proteome": "UP000473278",
        "gene": "hprK",
        "go_terms": [
            {
                "identifier": "GO:0000155",
                "name": "phosphorelay sensor kinase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0004672",
                "name": "protein kinase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0005524",
                "name": "ATP binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0000160",
                "name": "phosphorelay signal transduction system",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0006109",
                "name": "regulation of carbohydrate metabolic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "d357e6f73d5895aa8e8bb0c47224ff5b32885360",
        "counters": {
            "domain_architectures": 7521,
            "entries": 15,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 3,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "ssf": 2,
                "pfam": 2,
                "cdd": 1,
                "hamap": 1,
                "ncbifam": 1,
                "panther": 1,
                "interpro": 5
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 7521
        }
    }
}