GET /api/protein/UniProt/A0A6L4WNZ1/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A6L4WNZ1",
        "id": "A0A6L4WNZ1_9BACT",
        "source_organism": {
            "taxId": "2654171",
            "scientificName": "Poseidonibacter ostreae",
            "fullName": "Poseidonibacter ostreae"
        },
        "name": "Dihydroorotate dehydrogenase (quinone)",
        "description": [
            "Catalyzes the conversion of dihydroorotate to orotate with quinone as electron acceptor"
        ],
        "length": 352,
        "sequence": "MFCYNTVKKVLFKFEPETAHNIAECGLRIVGKCKILKNMMEKKNFKNNSKLSQELFGVTFTNPVGLAAGFDKNATMVKAMPSLGFGFTEIGTMTPKPQDGNAKPRMFRYPEEKSVQNAMGFNNEGAHKVLKNLKEVYPAAIPVGVNIGKNKTTPEEFALSDYKMLIKKFEATSDYLVINISSPNTPNLRDLQNEKFITELFTMAKEFTNKPILLKIAPDMEAQQAIELCKSAVNAGAAGIIATNTTIDYSLVPNCQDFGGLSGACLTEKSYSIFKEIAKELYGKTILISAGGISTGEQAYARIKAGASLVQSYSGLIFEGPSMVRKINEEILELMAKDGYENITEAIGSDLK",
        "proteome": "UP000461010",
        "gene": "pyrD",
        "go_terms": [
            {
                "identifier": "GO:0004152",
                "name": "dihydroorotate dehydrogenase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006207",
                "name": "'de novo' pyrimidine nucleobase biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0016020",
                "name": "membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0016627",
                "name": "oxidoreductase activity, acting on the CH-CH group of donors",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0005737",
                "name": "cytoplasm",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0006222",
                "name": "UMP biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "386746119d361a60cfbbc9964fada353b1100670",
        "counters": {
            "domain_architectures": 37617,
            "entries": 18,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "cdd": 1,
                "pfam": 1,
                "ncbifam": 4,
                "hamap": 1,
                "panther": 1,
                "pirsf": 1,
                "prosite": 1,
                "interpro": 6
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 37617
        }
    }
}