GET /api/protein/UniProt/A0A6J3S6A2/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A6J3S6A2",
        "id": "A0A6J3S6A2_TURTR",
        "source_organism": {
            "taxId": "9739",
            "scientificName": "Tursiops truncatus",
            "fullName": "Tursiops truncatus (Atlantic bottle-nosed dolphin)"
        },
        "name": "Uracil-DNA glycosylase-like domain-containing protein",
        "description": [
            "Recognizes base lesions in the genome and initiates base excision DNA repair. Acts as a monofunctional DNA glycosylase specific for uracil (U) residues in DNA with a preference for single-stranded DNA substrates. The activity is greater toward mismatches (U/G) compared to matches (U/A). Excises uracil (U), 5-formyluracil (fU) and uracil derivatives bearing an oxidized group at C5 [5-hydroxyuracil (hoU) and 5-hydroxymethyluracil (hmU)] in ssDNA and dsDNA, but not analogous cytosine derivatives (5-hydroxycytosine and 5-formylcytosine), nor other oxidized bases. The activity is damage-specific and salt-dependent. The substrate preference is the following: ssDNA > dsDNA (G pair) = dsDNA (A pair) at low salt concentration, and dsDNA (G pair) > dsDNA (A pair) > ssDNA at high salt concentration"
        ],
        "length": 298,
        "sequence": "MNLAYILFILDFFPTRRLPQCLSCDSVMAVPQAFPPGPLREGGALVEPQPSPRSSAEGFLEEELRLNAELKQLQFSEPVGVIYNPVEYAWEPHRSYVTRYCQGPKQVLFLGMNPGPFGMAQTGVPFGEVSVVRDWLGIGGPVQTPPQEHPKRPVLGLECPQSEVSGARFWGFFRNLCGQPEVFFRHCFVHNLCPLLLLAPSGRNLTPAELPAKQREQLLGVCDAALCRQVQLLGVRLVVGVGRLAEQRARRALASLMPEVQVEGLLHPSPRNPQANKGWEVVAKERLNELGLLPLLTK",
        "proteome": "UP000245320",
        "gene": "SMUG1",
        "go_terms": [
            {
                "identifier": "GO:0017065",
                "name": "single-strand selective uracil DNA N-glycosylase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006284",
                "name": "base-excision repair",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "6d3eb109c1e174cd82c598bd72ab8f3ce4283767",
        "counters": {
            "domain_architectures": 69726,
            "entries": 8,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "cdd": 1,
                "pfam": 1,
                "panther": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 69726
        }
    }
}