GET /api/protein/UniProt/A0A6J3RS79/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A6J3RS79",
"id": "A0A6J3RS79_TURTR",
"source_organism": {
"taxId": "9739",
"scientificName": "Tursiops truncatus",
"fullName": "Tursiops truncatus (Atlantic bottle-nosed dolphin)"
},
"name": "Ribonuclease inhibitor",
"description": [
"Ribonuclease inhibitor which inhibits RNASE1, RNASE2 and angiogenin (ANG). May play a role in redox homeostasis. Required to inhibit the cytotoxic tRNA ribonuclease activity of ANG in the cytoplasm in absence of stress. Relocates to the nucleus in response to stress, relieving inhibition of ANG in the cytoplasm, and inhibiting the angiogenic activity of ANG in the nucleus"
],
"length": 557,
"sequence": "MASRRGCLLNFLLLLTESPLPAPLPGTPQLTAAAGFLSCWPPLQGHSRHPPGALVTHLFRRCVWPCHVPQLCGPWQSLPGSPLPFLLLEADVDKGNTSPPTMKLDIQCEQLSDARWTELLPLIQQYEVVRLDDCGLTEVRCKDIGSALRANPSLTELSLRTNELGDSGVHLVLQGLQSPTCKIQKLNLQNCCLTEAGCRVLPGVLRSLSTLRELNLSDNPLGDAGLQLLCEGLLDPQCHLEKLQLEYCNLTAAACEPLAAVLRATRDLKELMVSNNDLGEAGIRELCRGLADSACQLEALKLENCGLTPANCKDLCGIVASQASLNELDLGSNPLGDAGIAELCPGLLSPGSQLKTLWLWECDITTSGCRDLCRILQAKETLKELSLAGNSLGDESARLLCDSLLQPGCQLESLWVKSCSLTAACCHHFGSMLTQNKRLLELQLSNNQLGDSGVQALCQALCQPGATLRVLWLGDCDVTDGACGGLASLLLTNRSLRELDLSNNGLGDPGVLQLLGSLEQPGCALEQLVLYDIYWTEVVEERLRALEGSKPGLRIIF",
"proteome": "UP000245320",
"gene": "RNH1",
"go_terms": [
{
"identifier": "GO:0005515",
"name": "protein binding",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 4,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "6c6700001968f766484bfa9da72223f5f64d30bb",
"counters": {
"domain_architectures": 106,
"entries": 14,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"pfam": 2,
"cdd": 1,
"cathgene3d": 1,
"ssf": 1,
"smart": 2,
"profile": 1,
"panther": 1,
"interpro": 5
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 106
}
}
}