GET /api/protein/UniProt/A0A6J3R6B6/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A6J3R6B6",
        "id": "A0A6J3R6B6_TURTR",
        "source_organism": {
            "taxId": "9739",
            "scientificName": "Tursiops truncatus",
            "fullName": "Tursiops truncatus (Atlantic bottle-nosed dolphin)"
        },
        "name": "F-box/LRR-repeat protein 12",
        "description": [
            "Substrate-recognition component of the SCF (SKP1-CUL1-F-box protein)-type E3 ubiquitin ligase complex. Mediates the polyubiquitination and proteasomal degradation of CAMK1 leading to disruption of cyclin D1/CDK4 complex assembly which results in G1 cell cycle arrest in lung epithelia"
        ],
        "length": 273,
        "sequence": "MRPKVMWHLLRRYMASRLHSLRMGGYLFSGSQAPQLSPALMRALGQKCPNLKRLCLHVANLSMVPITSLPCTLRTLELHSCEISMAWLLKEQDPTVLPLLECIVLDRVPAFRDEHLQGLTRFRALRSLVLGGTYRVTETGLDMGLQELSYLQRLEVLGCTLSADSTLLAISRHLRDVRKIRLTVRGLSAPGLSVLEGMPALESLCLLGPLITPEMPSPREILSSCLTMPKLRVLELQGLGWEGQEAERILSKGLPHCMVIVRACPKESMDWWM",
        "proteome": "UP000245320",
        "gene": "FBXL12",
        "go_terms": null,
        "protein_evidence": 4,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": null,
        "counters": {
            "domain_architectures": 0,
            "entries": 4,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "panther": 1,
                "interpro": 1
            },
            "proteome": 1,
            "taxonomy": 1
        }
    }
}