GET /api/protein/UniProt/A0A6J3R6B6/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A6J3R6B6",
"id": "A0A6J3R6B6_TURTR",
"source_organism": {
"taxId": "9739",
"scientificName": "Tursiops truncatus",
"fullName": "Tursiops truncatus (Atlantic bottle-nosed dolphin)"
},
"name": "F-box/LRR-repeat protein 12",
"description": [
"Substrate-recognition component of the SCF (SKP1-CUL1-F-box protein)-type E3 ubiquitin ligase complex. Mediates the polyubiquitination and proteasomal degradation of CAMK1 leading to disruption of cyclin D1/CDK4 complex assembly which results in G1 cell cycle arrest in lung epithelia"
],
"length": 273,
"sequence": "MRPKVMWHLLRRYMASRLHSLRMGGYLFSGSQAPQLSPALMRALGQKCPNLKRLCLHVANLSMVPITSLPCTLRTLELHSCEISMAWLLKEQDPTVLPLLECIVLDRVPAFRDEHLQGLTRFRALRSLVLGGTYRVTETGLDMGLQELSYLQRLEVLGCTLSADSTLLAISRHLRDVRKIRLTVRGLSAPGLSVLEGMPALESLCLLGPLITPEMPSPREILSSCLTMPKLRVLELQGLGWEGQEAERILSKGLPHCMVIVRACPKESMDWWM",
"proteome": "UP000245320",
"gene": "FBXL12",
"go_terms": null,
"protein_evidence": 4,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": null,
"counters": {
"domain_architectures": 0,
"entries": 4,
"isoforms": 0,
"proteomes": 1,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"panther": 1,
"interpro": 1
},
"proteome": 1,
"taxonomy": 1
}
}
}