GET /api/protein/UniProt/A0A6J3QRJ0/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A6J3QRJ0",
        "id": "A0A6J3QRJ0_TURTR",
        "source_organism": {
            "taxId": "9739",
            "scientificName": "Tursiops truncatus",
            "fullName": "Tursiops truncatus (Atlantic bottle-nosed dolphin)"
        },
        "name": "Peroxiredoxin-1",
        "description": [
            "Thiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides to water and alcohols, respectively. Plays a role in cell protection against oxidative stress by detoxifying peroxides and as sensor of hydrogen peroxide-mediated signaling events. Might participate in the signaling cascades of growth factors and tumor necrosis factor-alpha by regulating the intracellular concentrations of H(2)O(2). Reduces an intramolecular disulfide bond in GDPD5 that gates the ability to GDPD5 to drive postmitotic motor neuron differentiation"
        ],
        "length": 199,
        "sequence": "MSSGNAKIGHNAPQFKATAVMPDGQFKDISLSDYKGKYAVFFFYPLDFTFVCPTEIIAFRDRAEEFKKLNCQVIGASVDSHFCLLAWINTPKKQGGLGPMNIPLISDPKHTIAQEYGVLKAHEGISFRGLFIIDDKGIIQQITINDLPVGRSVDETLRLVQAFQFTDKHGEVCPAGWKPGSDTIKPDVQKSKEYFSKQK",
        "proteome": "UP000245320",
        "gene": "LOC117310160",
        "go_terms": [
            {
                "identifier": "GO:0016209",
                "name": "antioxidant activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0016491",
                "name": "oxidoreductase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0051920",
                "name": "peroxiredoxin activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "9db26b9b236ea914ef8a2d52a7760b3ae17fb31b",
        "counters": {
            "domain_architectures": 37286,
            "entries": 14,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "profile": 1,
                "ssf": 1,
                "pfam": 2,
                "cdd": 1,
                "panther": 1,
                "pirsf": 1,
                "interpro": 6
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 37286
        }
    }
}