General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A6J3Q8L8",
        "id": "A0A6J3Q8L8_TURTR",
        "source_organism": {
            "taxId": "9739",
            "scientificName": "Tursiops truncatus",
            "fullName": "Tursiops truncatus (Atlantic bottle-nosed dolphin)"
        },
        "name": "Lymphocyte antigen 96",
        "description": [
            "Binds bacterial lipopolysaccharide (LPS). Cooperates with TLR4 in the innate immune response to bacterial lipopolysaccharide (LPS), and with TLR2 in the response to cell wall components from Gram-positive and Gram-negative bacteria. Enhances TLR4-dependent activation of NF-kappa-B. Cells expressing both LY96 and TLR4, but not TLR4 alone, respond to LPS"
        ],
        "length": 160,
        "sequence": "MFPFMLFSALFSSTFTEPGEKRWICNSSDTSVWYSYCDNLKFPISINAEPCITLKGGRGNLYLYYIPRRDIKSLYFNIYVSFKSVNFPVRKQVICRGSDDDYSFCRALKGETVNTTISFSFKEIRFSKGRYDCITEAIAGNTEERLLCLNFTIIYHPDFS",
        "proteome": "UP000245320",
        "gene": "LY96",
        "go_terms": [
            {
                "identifier": "GO:0001530",
                "name": "lipopolysaccharide binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0035662",
                "name": "Toll-like receptor 4 binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0045087",
                "name": "innate immune response",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 4,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": null,
        "counters": {
            "domain_architectures": 0,
            "entries": 7,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "smart": 1,
                "panther": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1
        }
    }
}