HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A6J3PUQ3",
"id": "A0A6J3PUQ3_TURTR",
"source_organism": {
"taxId": "9739",
"scientificName": "Tursiops truncatus",
"fullName": "Tursiops truncatus (Atlantic bottle-nosed dolphin)"
},
"name": "Interleukin-1",
"description": [
"Anti-inflammatory antagonist of interleukin-1 family of proinflammatory cytokines such as interleukin-1beta/IL1B and interleukin-1alpha/IL1A. Protects from immune dysregulation and uncontrolled systemic inflammation triggered by IL1 for a range of innate stimulatory agents such as pathogens"
],
"length": 160,
"sequence": "METHETACYPLGKRPCEMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNTKLEEKIDVVPIEPHAMFLGIHGGKLCLACVKSGDEIKLGLEPVNITDLNSSKEEDKRFAFIRSDSGPTTSFESAACPGWFLCTALETDQPVGLTNTPQDAVQVTKFYFQQDQ",
"proteome": "UP000245320",
"gene": "IL1RN",
"go_terms": [
{
"identifier": "GO:0005125",
"name": "cytokine activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006954",
"name": "inflammatory response",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0006955",
"name": "immune response",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0005615",
"name": "extracellular space",
"category": {
"code": "C",
"name": "cellular_component"
}
},
{
"identifier": "GO:0005149",
"name": "interleukin-1 receptor binding",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "f15e08d01e5229ef19b1a28db55baa490c1fdc29",
"counters": {
"domain_architectures": 3786,
"entries": 12,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"smart": 1,
"ssf": 1,
"pfam": 1,
"panther": 1,
"prosite": 1,
"prints": 2,
"interpro": 4
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 3786
}
}
}