General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A6J3JMY8",
        "id": "A0A6J3JMY8_SAPAP",
        "source_organism": {
            "taxId": "9515",
            "scientificName": "Sapajus apella",
            "fullName": "Sapajus apella (Brown-capped capuchin)"
        },
        "name": "C-C motif chemokine 21",
        "description": [
            "Inhibits hemopoiesis and stimulates chemotaxis. Chemotactic in vitro for thymocytes and activated T-cells, but not for B-cells, macrophages, or neutrophils. Shows preferential activity towards naive T-cells. May play a role in mediating homing of lymphocytes to secondary lymphoid organs. Binds to atypical chemokine receptor ACKR4 and mediates the recruitment of beta-arrestin (ARRB1/2) to ACKR4"
        ],
        "length": 154,
        "sequence": "MAQSLALSLLIVVLAFGIPRTQGSDGGAQDCCLRYSLRKIPAKVVRGYRKQEPSLGCSIPAILFLPRKLSQPELCADPKKPWVQQLMQHLDKTPAPRKPSQNCRKDRGTPKAGKKGKGSKGCKRTEQSQTPKGPQPSEQPGALDTQPASPGFEA",
        "proteome": "UP000504640",
        "gene": "CCL21",
        "go_terms": [
            {
                "identifier": "GO:0008009",
                "name": "chemokine activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006955",
                "name": "immune response",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005576",
                "name": "extracellular region",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "8ac991f80946180dacb861b83ef74abe53f0c30a",
        "counters": {
            "domain_architectures": 25797,
            "entries": 10,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "smart": 1,
                "pfam": 1,
                "cdd": 1,
                "panther": 1,
                "interpro": 4
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 25797
        }
    }
}