HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A6J3IKQ5",
"id": "A0A6J3IKQ5_SAPAP",
"source_organism": {
"taxId": "9515",
"scientificName": "Sapajus apella",
"fullName": "Sapajus apella (Brown-capped capuchin)"
},
"name": "D-ribitol-5-phosphate cytidylyltransferase",
"description": [
"Cytidylyltransferase required for protein O-linked mannosylation. Catalyzes the formation of CDP-ribitol nucleotide sugar from D-ribitol 5-phosphate. CDP-ribitol is a substrate of FKTN during the biosynthesis of the phosphorylated O-mannosyl trisaccharide (N-acetylgalactosamine-beta-3-N-acetylglucosamine-beta-4-(phosphate-6-)mannose), a carbohydrate structure present in alpha-dystroglycan (DAG1), which is required for binding laminin G-like domain-containing extracellular proteins with high affinity. Shows activity toward other pentose phosphate sugars and mediates formation of CDP-ribulose or CDP-ribose using CTP and ribulose-5-phosphate or ribose-5-phosphate, respectively. Not involved in dolichol production"
],
"length": 422,
"sequence": "MEPGPPGSSRPTEPGPCLSSQQGADQAASASLQSAAGAQPGRHSLAVAAVLPAGGCGERMGVPTPKQFCPILERPLISYTLQALERVYWIKDIVVAVTGENMEVMKSIIQKYQHKRISLVEAGVTRHRSIFNGLKALAEDQLNCKLSKPEIVIVHDAVRPFVEEDTLLKVVTAAKKHGAAGAIRPLVSTVISPSADGCLDHSLERARHRASEMPQAFLFDVIYEAYQQCSDYDLEFGTECLQLALKYCCTKAKLVEGSPDLWKVTYKRDLYAVESIIKEKISQEICVVTDIEEDNKYVSHLLEEVLKSELNHVKVTSEALCHAGRDLQQIILDQCYNFVCVNVMTSDFQETQKLLSMLEESNLSILYPVVVVSVHFLDFKLVPPSQKMESLMLIREFAKEVKKRNIWLCGLLISYPQDEQEH",
"proteome": "UP000504640",
"gene": "CRPPA",
"go_terms": [
{
"identifier": "GO:0070567",
"name": "cytidylyltransferase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0003824",
"name": "catalytic activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0008299",
"name": "isoprenoid biosynthetic process",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "f900ad3d220e7dd429bad9a01e037b72bc5d1fe5",
"counters": {
"domain_architectures": 945,
"entries": 11,
"isoforms": 0,
"proteomes": 1,
"sets": 3,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"cdd": 1,
"ssf": 1,
"pfam": 2,
"panther": 1,
"prosite": 1,
"interpro": 4
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 945
}
}
}