HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A6J3IFS3",
"id": "A0A6J3IFS3_SAPAP",
"source_organism": {
"taxId": "9515",
"scientificName": "Sapajus apella",
"fullName": "Sapajus apella (Brown-capped capuchin)"
},
"name": "T-cell surface glycoprotein CD3 gamma chain",
"description": [
"Part of the TCR-CD3 complex present on T-lymphocyte cell surface that plays an essential role in adaptive immune response. When antigen presenting cells (APCs) activate T-cell receptor (TCR), TCR-mediated signals are transmitted across the cell membrane by the CD3 chains CD3D, CD3E, CD3G and CD3Z. All CD3 chains contain immunoreceptor tyrosine-based activation motifs (ITAMs) in their cytoplasmic domain. Upon TCR engagement, these motifs become phosphorylated by Src family protein tyrosine kinases LCK and FYN, resulting in the activation of downstream signaling pathways. In addition to this role of signal transduction in T-cell activation, CD3G plays an essential role in the dynamic regulation of TCR expression at the cell surface. Indeed, constitutive TCR cycling is dependent on the di-leucine-based (diL) receptor-sorting motif present in CD3G"
],
"length": 210,
"sequence": "MGGASLAAAQTDWLLRAAPRFCQRTETDMEQGKGLAGLILAVTLLQGTLVQSNKGERLLTVEDRQEDGSVLLTCKVQDKNVTWFKDGKIISFLPASQKSWNLGSNTKDPRGMYQCKGSKDKSKPLQLYYRMCQNCIELNAATISGFVFAEIVSIFFLAVGVYFIAGQDGVRQSRASDKQTLLPNDQLYQPLKDREDDQYSHLQGNQLRRN",
"proteome": "UP000504640",
"gene": "CD3G",
"go_terms": [
{
"identifier": "GO:0004888",
"name": "transmembrane signaling receptor activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0007166",
"name": "cell surface receptor signaling pathway",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0016020",
"name": "membrane",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 4,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "4a614829109fd5851ca0701a5e3ac04533267cda",
"counters": {
"domain_architectures": 613,
"entries": 14,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"cathgene3d": 1,
"smart": 2,
"pfam": 2,
"profile": 1,
"panther": 1,
"interpro": 6
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 613
}
}
}