GET /api/protein/UniProt/A0A6J3I5J8/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A6J3I5J8",
"id": "A0A6J3I5J8_SAPAP",
"source_organism": {
"taxId": "9515",
"scientificName": "Sapajus apella",
"fullName": "Sapajus apella (Brown-capped capuchin)"
},
"name": "stearoyl-CoA 9-desaturase",
"description": null,
"length": 359,
"sequence": "MPAHLLQEEISSSYTTTTTITAPPSRVPQNGEDKLEKTPLYLEEDIRPDIKDDIYDPTYKDKEGPRPKVEYVWRNIILMSLLHLGALYGIILIPTCKFYTWLWGLFYYFVSALGITAGVHRLWSHRTYKARLPLRVFLIIANTMAFQNDVFEWARDHRAHHKFSETDADPHNSRRGFFFSHVGWLLVRKHPAVKEKGGMLDLSDLKAEKLVMFQRRYYKPGVLLMCFILPTLVPFYFWGETFQHSLYVATFLRYAVVLNATWLVNSAAHLYGYRPYDKNISPRENILVSLGAVGEGFHNYHHSFPYDYSASEYRWHINLTTFFIDCMAALGLAYDRKKVSKAAILARIKRTGDGSYKSG",
"proteome": "UP000504640",
"gene": "SCD",
"go_terms": [
{
"identifier": "GO:0016717",
"name": "oxidoreductase activity, acting on paired donors, with oxidation of a pair of donors resulting in the reduction of molecular oxygen to two molecules of water",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": null,
"counters": {
"domain_architectures": 0,
"entries": 6,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cdd": 1,
"panther": 1,
"prosite": 1,
"prints": 1,
"interpro": 2
},
"proteome": 1,
"taxonomy": 1
}
}
}