General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A6J3I0Q6",
        "id": "A0A6J3I0Q6_SAPAP",
        "source_organism": {
            "taxId": "9515",
            "scientificName": "Sapajus apella",
            "fullName": "Sapajus apella (Brown-capped capuchin)"
        },
        "name": "Max-like protein X",
        "description": [
            "Transcription regulator. Forms a sequence-specific DNA-binding protein complex with MAD1, MAD4, MNT, WBSCR14 and MLXIP which recognizes the core sequence 5'-CACGTG-3'. The TCFL4-MAD1, TCFL4-MAD4, TCFL4-WBSCR14 complexes are transcriptional repressors. Plays a role in transcriptional activation of glycolytic target genes. Involved in glucose-responsive gene regulation"
        ],
        "length": 214,
        "sequence": "MTESGASPEDPWVKVEYAYSDNSLDPDDEDSDYHQEAYKESYKDRRRRAHTQAEQKRRDAIKRGYDDLQTIVPTCQQQDFSIGSQKLSKAIVLQKTIDYIQFLHKEKKKQEEEVSTLRKDVTALKIMKVNYEQIVKAHQDNPHEGEDQVSDQVKFNVFQGIMDSLFQSFNASISVTSFQELSACVFSWIEEHCKPQTLREIVIGVLHQLKNQLY",
        "proteome": "UP000504640",
        "gene": "MLX",
        "go_terms": [
            {
                "identifier": "GO:0046983",
                "name": "protein dimerization activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 4,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "15b86a07eaabcbc71b6ebb705399c8a22c21f484",
        "counters": {
            "domain_architectures": 146351,
            "entries": 10,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "profile": 1,
                "cdd": 1,
                "pfam": 1,
                "smart": 1,
                "panther": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 146351
        }
    }
}