GET /api/protein/UniProt/A0A6J3HBN8/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A6J3HBN8",
"id": "A0A6J3HBN8_SAPAP",
"source_organism": {
"taxId": "9515",
"scientificName": "Sapajus apella",
"fullName": "Sapajus apella (Brown-capped capuchin)"
},
"name": "Hyaluronan and proteoglycan link protein 4",
"description": [
"Essential for the proper localization of brevican (BCAN), mainly as a perineuronal nets (PNNs)-type deposition in the brainstem and cerebellum thereby playing a key role in the formation and structural organization of PNNs. Contributes to the formation and transmission of inhibitory GABAergic synapses between Purkinje cells and deep cerebellar nuclei neurons"
],
"length": 402,
"sequence": "MVCPRAALGPGALWAAAWGVLLLTAPAGAQRGRKKVVHVLEGESGSVVVQTAPGQVVSHRGGTIVLPCRYHYEAAAHGHDGVRLKWTKVVDPLAFTDVFVALGPQHRAFGSYRGRAELQGDGPGDASLVLRNVTLQDYGRYECEVTNELEDDAGMVKLDLEGVVFPYHPRGGRYKLTFAEAQRACAEQDGILASAEQLHTAWRDGLDWCNAGWLRDGSVQYPVSRPREPCGGLGGTGSAGAHGGANGGVRNYGYRHNAEERYDAFCFTSNLPGRVFFLKPLRPVPFSGAARACAARGAAVAKVGQLFAAWKLQLLDRCTAGWLADGSARYPIVNPRARCGGRWPGVRSLGFPDATRRLFGVYCYRAPGAPDPAPGGWGWGWAGGGGWAGGARDPAAWTPLRV",
"proteome": "UP000504640",
"gene": "HAPLN4",
"go_terms": [
{
"identifier": "GO:0005540",
"name": "hyaluronic acid binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0007155",
"name": "cell adhesion",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "155a6f2af894beb143468523a189c467075d2d7f",
"counters": {
"domain_architectures": 3866,
"entries": 25,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 2,
"profile": 2,
"ssf": 2,
"pfam": 2,
"smart": 4,
"panther": 1,
"prints": 1,
"prosite": 1,
"interpro": 10
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 3866
}
}
}