GET /api/protein/UniProt/A0A6J3GYU2/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A6J3GYU2",
        "id": "A0A6J3GYU2_SAPAP",
        "source_organism": {
            "taxId": "9515",
            "scientificName": "Sapajus apella",
            "fullName": "Sapajus apella (Brown-capped capuchin)"
        },
        "name": "Phosphomannomutase",
        "description": [
            "Involved in the synthesis of the GDP-mannose and dolichol-phosphate-mannose required for a number of critical mannosyl transfer reactions"
        ],
        "length": 251,
        "sequence": "MAVTPQGARRKERVLCLFDVDGTLTPARQKLRSRVQIGVVGGSDYSKIAEQLGDGDEVIEKFDYVFAENGTVQYKHGRLLSKQTIQNHLGEELLQDLINFCLSYMALLRLPKKRGTFIEFRNGMLNISPIGRSCTLEERIEFSELDKKEKIREKFVEALKTEFAGKGLRFSRGGMISFDVFPEGWDKRYCLDSLDEDSFDTIHFFGNETSPGGNDFEIFADPRTVGHSVVSPQDTVQRCREIFFPETAHEA",
        "proteome": "UP000504640",
        "gene": "PMM1",
        "go_terms": [
            {
                "identifier": "GO:0004615",
                "name": "phosphomannomutase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0009298",
                "name": "GDP-mannose biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "f76e44d8be205a2bfb272f9168b5af1ebaf94506",
        "counters": {
            "domain_architectures": 7140,
            "entries": 16,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "cdd": 1,
                "ssf": 1,
                "sfld": 4,
                "panther": 1,
                "ncbifam": 1,
                "pfam": 1,
                "interpro": 5
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 7140
        }
    }
}