General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A6J3GU73",
        "id": "A0A6J3GU73_SAPAP",
        "source_organism": {
            "taxId": "9515",
            "scientificName": "Sapajus apella",
            "fullName": "Sapajus apella (Brown-capped capuchin)"
        },
        "name": "Protein S100-A3",
        "description": [
            "Binds both calcium and zinc. May be involved in calcium-dependent cuticle cell differentiation, hair shaft and hair cuticular barrier formation"
        ],
        "length": 101,
        "sequence": "MTRPLEQAVAAIVCTFQEYAGRCGDKHKLCQAELKELLQKELPTWTPTEFRECDYNKFMSVLDTNKDCEVDFVEYVRSLACLCLYCHEYFKDCAPEPPCPQ",
        "proteome": "UP000504640",
        "gene": "S100A3",
        "go_terms": [
            {
                "identifier": "GO:0046914",
                "name": "transition metal ion binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "9fbe415715d177c71b45cd24325edde000517727",
        "counters": {
            "domain_architectures": 10240,
            "entries": 11,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "cdd": 1,
                "pfam": 1,
                "smart": 1,
                "panther": 1,
                "prosite": 1,
                "interpro": 4
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 10240
        }
    }
}