HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A6J3G2Q7",
"id": "A0A6J3G2Q7_SAPAP",
"source_organism": {
"taxId": "9515",
"scientificName": "Sapajus apella",
"fullName": "Sapajus apella (Brown-capped capuchin)"
},
"name": "Dual specificity protein phosphatase",
"description": [
"Dual specificity phosphatase able to dephosphorylate phosphotyrosine, phosphoserine and phosphothreonine residues, with a preference for phosphotyrosine as a substrate",
"Dual specificity phosphatase that dephosphorylates MAPK8/JNK and MAPK14/p38, but not MAPK1/ERK2, in vitro. Exhibits intrinsic phosphatase activity towards both phospho-seryl/threonyl and -tyrosyl residues, with similar specific activities in vitro"
],
"length": 198,
"sequence": "MDSLQKQDLRRPKIHRAARGAPYQPPTLASLQRLLWVRQSATLNHINEVWPRLFLGDAYAARDKSKLTQLGITHIVNAAAGKFQVDTGAKFYRGMSLEYYGIEADDNPFFDLSVYFLPVARYIRAALSLPQGRVLVHCAMGVSRSATLVLAYLMIYENMTLVEAIQTVQAHRNICPNSGFLRQLQVLDNRLGQETGRL",
"proteome": "UP000504640",
"gene": "DUSP13",
"go_terms": [
{
"identifier": "GO:0006470",
"name": "protein dephosphorylation",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0016311",
"name": "dephosphorylation",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0008138",
"name": "protein tyrosine/serine/threonine phosphatase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "15742d355813370d995348f784781e84405a14d7",
"counters": {
"domain_architectures": 53529,
"entries": 16,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"smart": 1,
"profile": 2,
"pfam": 1,
"panther": 1,
"prosite": 1,
"prints": 2,
"interpro": 6
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 53529
}
}
}