GET /api/protein/UniProt/A0A6J3FID6/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A6J3FID6",
"id": "A0A6J3FID6_SAPAP",
"source_organism": {
"taxId": "9515",
"scientificName": "Sapajus apella",
"fullName": "Sapajus apella (Brown-capped capuchin)"
},
"name": "Tetraspanin",
"description": [
"May play a role in signalling in oligodendrocytes in the early stages of their terminal differentiation into myelin-forming glia and may also function in stabilizing the mature sheath"
],
"length": 193,
"sequence": "MGRFRGGLRCIKYLLLGFNLLFWLAGSAVIAFGLWFRFGGAIKELSSEDKSPEYFYVGLYVLVGAGALMMAVGFFGCCGAMRESQCVLGSFFTCLLVIFAAEVTTGVFAFIGKGIAIRHVQTMYEEAYNDYLKDRGKGNGTLITFHSTFQCCGKESSEQVQPTCPKELLGHKICGMIFSMVLCCAIRNSRDVI",
"proteome": "UP000504640",
"gene": "TSPAN2",
"go_terms": [
{
"identifier": "GO:0016020",
"name": "membrane",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "2f035c93bc0f873636b5d7b827745b2654062619",
"counters": {
"domain_architectures": 63859,
"entries": 11,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"pirsf": 1,
"pfam": 1,
"panther": 1,
"prosite": 1,
"prints": 1,
"interpro": 4
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 63859
}
}
}