General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A6J3EB53",
        "id": "A0A6J3EB53_AYTFU",
        "source_organism": {
            "taxId": "219594",
            "scientificName": "Aythya fuligula",
            "fullName": "Aythya fuligula (Tufted duck)"
        },
        "name": "Protein S100",
        "description": [
            "May function as calcium sensor and modulator, contributing to cellular calcium signaling. May function by interacting with other proteins, such as TPR-containing proteins, and indirectly play a role in many physiological processes such as the reorganization of the actin cytoskeleton and in cell motility. Binds 2 calcium ions. Calcium binding is cooperative"
        ],
        "length": 92,
        "sequence": "MAAPLDQAIGLLVATFHKYSGKEGDKNTLSKGELKELIQKELTIGPKLKDAEIAGLMDDLDRNKDQEVNFQEYVTFLGALAMIYNDALLQYK",
        "proteome": "UP000504639",
        "gene": "LOC116499699",
        "go_terms": [
            {
                "identifier": "GO:0005509",
                "name": "calcium ion binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "9fbe415715d177c71b45cd24325edde000517727",
        "counters": {
            "domain_architectures": 10240,
            "entries": 16,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cdd": 1,
                "cathgene3d": 1,
                "pfam": 1,
                "smart": 2,
                "ssf": 1,
                "profile": 1,
                "panther": 1,
                "prosite": 2,
                "interpro": 6
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 10240
        }
    }
}