GET /api/protein/UniProt/A0A6J3E7V2/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A6J3E7V2",
        "id": "A0A6J3E7V2_AYTFU",
        "source_organism": {
            "taxId": "219594",
            "scientificName": "Aythya fuligula",
            "fullName": "Aythya fuligula (Tufted duck)"
        },
        "name": "MICOS complex subunit MIC10",
        "description": [
            "Component of the MICOS complex, a large protein complex of the mitochondrial inner membrane that plays crucial roles in the maintenance of crista junctions, inner membrane architecture, and formation of contact sites to the outer membrane"
        ],
        "length": 77,
        "sequence": "MASEGELGRKWDRCLADSAVKLGAGFGLGIVFSVIFFKRKTWPIAFGSGMGLGMAYSNCQHDFQSPYLLHGKFVKEQ",
        "proteome": "UP000504639",
        "gene": "MICOS10",
        "go_terms": [
            {
                "identifier": "GO:0005743",
                "name": "mitochondrial inner membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0061617",
                "name": "MICOS complex",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "1a8ab349176e192a217a2917f1538fe4436c2faf",
        "counters": {
            "domain_architectures": 4212,
            "entries": 3,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 1,
                "panther": 1,
                "interpro": 1
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 4212
        }
    }
}