HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A6J3CJE4",
"id": "A0A6J3CJE4_AYTFU",
"source_organism": {
"taxId": "219594",
"scientificName": "Aythya fuligula",
"fullName": "Aythya fuligula (Tufted duck)"
},
"name": "Uridine phosphorylase",
"description": [
"Catalyzes the reversible phosphorylytic cleavage of uridine to uracil and ribose-1-phosphate which can then be utilized as carbon and energy sources or in the rescue of pyrimidine bases for nucleotide synthesis. Shows broad substrate specificity and can also accept deoxyuridine and other analogous compounds"
],
"length": 313,
"sequence": "MAPGISNEKKKEDEQSSKGNAIHLCNPHLEKMKEDILYHFALGTGTHDFPALFGDVKFVCVGGSPSRMKAFIAYIAEELGLGDQDGDYPNICAGTDRYAMYKVGPVLSVSHGMGIPSISIMLHELIKLLYHAKCSNITLIRIGTSGGIGLEPGSVVITRQSVDATFKPQFEQVVLGKTIIRSTNLDEELAKELMQCSKEINEFNTVIGNTMCTLDFYEGQGRLDGAICLYNEEEKLQYLKAAYDSGVRNIEMESSVFAAMCNLSGVRAAVVCVTLLNRLEGDQISSSHDILVEYQQRPQKLVGYFIKKSLGKV",
"proteome": "UP000504639",
"gene": "UPP1",
"go_terms": [
{
"identifier": "GO:0003824",
"name": "catalytic activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0009116",
"name": "nucleoside metabolic process",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0004850",
"name": "uridine phosphorylase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0009166",
"name": "nucleotide catabolic process",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0005737",
"name": "cytoplasm",
"category": {
"code": "C",
"name": "cellular_component"
}
},
{
"identifier": "GO:0016763",
"name": "pentosyltransferase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "27552274e8941821ae0d138350daef5fe3adde72",
"counters": {
"domain_architectures": 85785,
"entries": 11,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"cdd": 1,
"ssf": 1,
"pfam": 1,
"panther": 1,
"ncbifam": 1,
"prosite": 1,
"interpro": 4
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 85785
}
}
}