GET /api/protein/UniProt/A0A6J2YTC7/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A6J2YTC7",
"id": "A0A6J2YTC7_SITOR",
"source_organism": {
"taxId": "7048",
"scientificName": "Sitophilus oryzae",
"fullName": "Sitophilus oryzae (Rice weevil)"
},
"name": "Mitochondrial import inner membrane translocase subunit",
"description": [
"Mitochondrial intermembrane chaperone that participates in the import and insertion of some multi-pass transmembrane proteins into the mitochondrial inner membrane. Also required for the transfer of beta-barrel precursors from the TOM complex to the sorting and assembly machinery (SAM complex) of the outer membrane. Acts as a chaperone-like protein that protects the hydrophobic precursors from aggregation and guide them through the mitochondrial intermembrane space"
],
"length": 95,
"sequence": "MSVPLPPGTGLENIDGEQIKTFKDFLISYNKLTEMCFIDCVTDFTSRNIKHAEDKCALNCLEKFLKVNQRISQRFQEFQVLANENALAAVKQTGS",
"proteome": "UP000504635",
"gene": "LOC115890452",
"go_terms": null,
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "f9178374a5901be0d54a7f9dfe55ffbddb0efa3a",
"counters": {
"domain_architectures": 17178,
"entries": 7,
"isoforms": 0,
"proteomes": 1,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"pfam": 1,
"ssf": 1,
"panther": 1,
"interpro": 3
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 17178
}
}
}