GET /api/protein/UniProt/A0A6J2WGV4/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A6J2WGV4",
"id": "A0A6J2WGV4_CHACN",
"source_organism": {
"taxId": "29144",
"scientificName": "Chanos chanos",
"fullName": "Chanos chanos (Milkfish)"
},
"name": "Translocon-associated protein subunit beta",
"description": [
"TRAP proteins are part of a complex whose function is to bind calcium to the ER membrane and thereby regulate the retention of ER resident proteins"
],
"length": 184,
"sequence": "MRALCVFALIAVLSAVTGEEGARLLASKSLLNRYAVEGRDLTLQYNIYNVGTSAALEVELSDDSFPPEDFGIVSGMLNVKWDRIAPASNVSHTVVLRPLKAGYFNFTSATVSYLAQEGGQVVVGYTSAPGQGGILAQREFDRRFSPHYLDWAAFGVMTLPSIGIPLLLWYSSKRKYDSPKSKKN",
"proteome": "UP000504632",
"gene": "ssr2",
"go_terms": [
{
"identifier": "GO:0005783",
"name": "endoplasmic reticulum",
"category": {
"code": "C",
"name": "cellular_component"
}
},
{
"identifier": "GO:0016020",
"name": "membrane",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "85f328a6e8c188d6f59aa1cbc8542042aab59838",
"counters": {
"domain_architectures": 4029,
"entries": 4,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"panther": 1,
"pirsf": 1,
"pfam": 1,
"interpro": 1
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 4029
}
}
}