GET /api/protein/UniProt/A0A6J2V541/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A6J2V541",
"id": "A0A6J2V541_CHACN",
"source_organism": {
"taxId": "29144",
"scientificName": "Chanos chanos",
"fullName": "Chanos chanos (Milkfish)"
},
"name": "Gap junction protein",
"description": [
"One gap junction consists of a cluster of closely packed pairs of transmembrane channels, the connexons, through which materials of low MW diffuse from one cell to a neighboring cell"
],
"length": 273,
"sequence": "MGDWGFLSKLLDSVQAHSTVIGKIWMSVLFIFRILVLGAGAESVWGDEQSGFVCNTETPGCELVCYDWIFPISHIRFWVLQIIFVSTPTLVYLGHAVTVIHKENKLREQRQRDQTVKVPKYTDDNGRVRIRGTLLGSYLTQLFAKILIEIGFIVGQYYLYGFVMVPRFLCKKFPCHTKVECFMSRPTEKTIFIIFMLAVACVSLALNVLEVLYLLCKRIRTNSTKRYMGHFTSELDNSLPPLFPTDLTAADNFMHKEKVQFDSGKCPEGSSFD",
"proteome": "UP000504632",
"gene": "gja13.2",
"go_terms": [
{
"identifier": "GO:0007154",
"name": "cell communication",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0005922",
"name": "connexin complex",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "8a825e27a9aba93bc304f1472053b3edc06a046c",
"counters": {
"domain_architectures": 16666,
"entries": 13,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"pfam": 1,
"smart": 2,
"panther": 1,
"prints": 1,
"prosite": 2,
"interpro": 5
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 16666
}
}
}