GET /api/protein/UniProt/A0A6J2T0Y2/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A6J2T0Y2",
        "id": "A0A6J2T0Y2_DROLE",
        "source_organism": {
            "taxId": "7225",
            "scientificName": "Drosophila lebanonensis",
            "fullName": "Drosophila lebanonensis (Fruit fly)"
        },
        "name": "Cytochrome b-c1 complex subunit 6",
        "description": [
            "Component of the ubiquinol-cytochrome c oxidoreductase, a multisubunit transmembrane complex that is part of the mitochondrial electron transport chain which drives oxidative phosphorylation"
        ],
        "length": 88,
        "sequence": "MAFNKLIEFMSFPVVKADDEEDLVDPQTALREKCQTKGHIESLYTKYQECNDRVNSRSKTTETCMEELFDYVAELDHCVAHSLFSKLK",
        "proteome": "UP000504634",
        "gene": "LOC115621145",
        "go_terms": [
            {
                "identifier": "GO:0006122",
                "name": "mitochondrial electron transport, ubiquinol to cytochrome c",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "d3fede23f3ba05cc274f57f1babcc6460394479c",
        "counters": {
            "domain_architectures": 4545,
            "entries": 8,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "pfam": 1,
                "pirsf": 1,
                "panther": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 4545
        }
    }
}