GET /api/protein/UniProt/A0A6J2T0Y2/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A6J2T0Y2",
"id": "A0A6J2T0Y2_DROLE",
"source_organism": {
"taxId": "7225",
"scientificName": "Drosophila lebanonensis",
"fullName": "Drosophila lebanonensis (Fruit fly)"
},
"name": "Cytochrome b-c1 complex subunit 6",
"description": [
"Component of the ubiquinol-cytochrome c oxidoreductase, a multisubunit transmembrane complex that is part of the mitochondrial electron transport chain which drives oxidative phosphorylation"
],
"length": 88,
"sequence": "MAFNKLIEFMSFPVVKADDEEDLVDPQTALREKCQTKGHIESLYTKYQECNDRVNSRSKTTETCMEELFDYVAELDHCVAHSLFSKLK",
"proteome": "UP000504634",
"gene": "LOC115621145",
"go_terms": [
{
"identifier": "GO:0006122",
"name": "mitochondrial electron transport, ubiquinol to cytochrome c",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "d3fede23f3ba05cc274f57f1babcc6460394479c",
"counters": {
"domain_architectures": 4545,
"entries": 8,
"isoforms": 0,
"proteomes": 1,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"pfam": 1,
"pirsf": 1,
"panther": 1,
"interpro": 3
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 4545
}
}
}