GET /api/protein/UniProt/A0A6J2S0G4/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A6J2S0G4",
        "id": "A0A6J2S0G4_COTGO",
        "source_organism": {
            "taxId": "56716",
            "scientificName": "Cottoperca gobio",
            "fullName": "Cottoperca gobio (Frogmouth)"
        },
        "name": "Zinc finger protein 593",
        "description": [
            "Involved in pre-60S ribosomal particles maturation by promoting the nuclear export of the 60S ribosome. Negatively modulates the DNA binding activity of Oct-2 and therefore its transcriptional regulatory activity"
        ],
        "length": 129,
        "sequence": "MGKSTQTGNHKSDRKKHIARTWKTKHRTKDLDQIHSDMTTEAAAKLLHQAVDSDVTGCAQHYCLHCARYFVDLRSMKEHFKTKVHKRRLKKLREEPYTQAEADRAAGMGSYIAPKKVEVKTQTVEEDMN",
        "proteome": "UP000504630",
        "gene": "znf593",
        "go_terms": [
            {
                "identifier": "GO:0003676",
                "name": "nucleic acid binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0008270",
                "name": "zinc ion binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "4a0fc2dbd27baeedae4fa882d4eb12442d4a428d",
        "counters": {
            "domain_architectures": 7969,
            "entries": 11,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "cathgene3d": 1,
                "smart": 1,
                "panther": 1,
                "pfam": 1,
                "prosite": 1,
                "interpro": 5
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 7969
        }
    }
}