General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A6J2QTS7",
        "id": "A0A6J2QTS7_COTGO",
        "source_organism": {
            "taxId": "56716",
            "scientificName": "Cottoperca gobio",
            "fullName": "Cottoperca gobio (Frogmouth)"
        },
        "name": "Phytanoyl-CoA dioxygenase domain-containing protein 1",
        "description": [
            "2-oxoglutarate(2OG)-dependent dioxygenase that catalyzes the conversion of 2-oxoglutarate to succinate and CO(2) in an iron-dependent manner. However, does not couple 2OG turnover to the hydroxylation of acyl-coenzyme A derivatives, implying that it is not directly involved in phytanoyl coenzyme-A metabolism. Does not show detectable activity towards fatty acid CoA thioesters"
        ],
        "length": 300,
        "sequence": "MDFMTDRDVQKYMEDGYVVLDGLLTPQECDELRQRMAEIVEHMDIPHHCRTTFSTYHDEQLKTQMQGNADYFITSGDKIRFFFEKGAFDDKGEFIVPKQRSLNKVGHALHAYEPVYKKVTHSPNVQGMAKKLGLVSPVILQSMFIFKQPGIGGEVTPHQDATFLYTEPLGRVMGLWIALEDATANNGCLWFIPGSHNSGISRRMVRTPKGTFPLTDFSGREQTYDDEKFVVAPVKKGNSLKWLSFLLPREGVHRSAETPRTTSRHVYTFHLCMEAQTPSWSPDNWLQPTEELPFPPLYAK",
        "proteome": "UP000504630",
        "gene": "phyhd1",
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "96df0262c251125e4e3c528cd9e85e7757a33506",
        "counters": {
            "domain_architectures": 51362,
            "entries": 5,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "pfam": 1,
                "panther": 1,
                "interpro": 1
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 51362
        }
    }
}