General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A6J2QQF3",
        "id": "A0A6J2QQF3_COTGO",
        "source_organism": {
            "taxId": "56716",
            "scientificName": "Cottoperca gobio",
            "fullName": "Cottoperca gobio (Frogmouth)"
        },
        "name": "Actin-binding Rho-activating protein",
        "description": [
            "Acts as an activator of serum response factor (SRF)-dependent transcription possibly by inducing nuclear translocation of MKL1 or MKL2 and through a mechanism requiring Rho-actin signaling"
        ],
        "length": 173,
        "sequence": "MPEKWKDQWGNAAKRYKKKAGDANKINALFKRYSAVGNLKSRWQSWASEHTVNQKLNPFCKYFNHDYSMSLRLQKGEEGYVRRKEGTKTAGKAKRAEQHIHREIGDMCFVIRTMADQMERPTFTFGQLFDRYVRISDKVVGILMRARKHRKVAFEGEMLWQGQDEGVIITLLV",
        "proteome": "UP000504630",
        "gene": "abrab",
        "go_terms": [
            {
                "identifier": "GO:0003779",
                "name": "actin binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0035025",
                "name": "positive regulation of Rho protein signal transduction",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 4,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "de7a73a65be9effee56250076dc492ab1fd77238",
        "counters": {
            "domain_architectures": 4028,
            "entries": 7,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "smart": 1,
                "pfam": 1,
                "panther": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 4028
        }
    }
}