GET /api/protein/UniProt/A0A6J2PUG3/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A6J2PUG3",
"id": "A0A6J2PUG3_COTGO",
"source_organism": {
"taxId": "56716",
"scientificName": "Cottoperca gobio",
"fullName": "Cottoperca gobio (Frogmouth)"
},
"name": "Troponin I, fast skeletal muscle-like",
"description": [
"Troponin I is the inhibitory subunit of troponin, the thin filament regulatory complex which confers calcium-sensitivity to striated muscle actomyosin ATPase activity"
],
"length": 172,
"sequence": "MSDGKKMSSSRRHHLKSVILQIAASWLEQEVIDIAAAKAAYIAEKCVLPDLSGDQASLMEICKKLHQKIDQIDEERYDNESKVTKSDKEIDDLKIKVVELAGVKKPALKKVRMSADSMLQALLGGKHKVTMDLRANLKQVKKEVKEEAGEAVGDWRKNVEGKADRKKMFETS",
"proteome": "UP000504630",
"gene": "LOC115009259",
"go_terms": [
{
"identifier": "GO:0005861",
"name": "troponin complex",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "e87376e55612704cb38509e8056e1fce9be7d25a",
"counters": {
"domain_architectures": 15375,
"entries": 8,
"isoforms": 0,
"proteomes": 1,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 2,
"ssf": 1,
"panther": 1,
"pfam": 1,
"interpro": 3
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 15375
}
}
}