GET /api/protein/UniProt/A0A6J2P7B5/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A6J2P7B5",
        "id": "A0A6J2P7B5_COTGO",
        "source_organism": {
            "taxId": "56716",
            "scientificName": "Cottoperca gobio",
            "fullName": "Cottoperca gobio (Frogmouth)"
        },
        "name": "Peptidyl-prolyl cis-trans isomerase",
        "description": [
            "PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides"
        ],
        "length": 237,
        "sequence": "MQELRGEVWQYSSSLMCFVNGLLLGNDKDLAGWAKNQWSFSFTRPQAFYMALTEDYYTKHLRDNGHQFVFMDIEIAGEAVGRLLFELFSDVCPKTSKNFEALCTGERGLSESGIPLCYKGSLFHRVVPNGWVQGGDISPERKGDGGESIYGQTFEDESFAVSHARRGSLGMANKGPHSNGSQFYITLQPTPWMDRTYVAFGHVVEGVNVLRRLEEAPTCNERPKYECKVTDCGVFKF",
        "proteome": "UP000504630",
        "gene": "ppil6",
        "go_terms": [
            {
                "identifier": "GO:0003755",
                "name": "peptidyl-prolyl cis-trans isomerase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0000413",
                "name": "protein peptidyl-prolyl isomerization",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "ec13550bd3f45711d77ed9b599f14cde4aa876a9",
        "counters": {
            "domain_architectures": 108117,
            "entries": 8,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "pfam": 1,
                "profile": 1,
                "panther": 1,
                "prints": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 108117
        }
    }
}