GET /api/protein/UniProt/A0A6J2NAY8/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A6J2NAY8",
"id": "A0A6J2NAY8_9CHIR",
"source_organism": {
"taxId": "89673",
"scientificName": "Phyllostomus discolor",
"fullName": "Phyllostomus discolor (pale spear-nosed bat)"
},
"name": "Deoxyribonuclease TATDN1",
"description": [
"Deoxyribonuclease which catalyzes (in vitro) the decatenation of kinetoplast DNA, which are circular DNA catenated to each other, producing linear DNA molecules. Plays an important role in chromosomal segregation and cell cycle progression during eye development probably via its DNA decatenation activity"
],
"length": 297,
"sequence": "MSRFKFVDIGINLTDPMFRGIYRGVQKHQDDLQDVIQRAVQIGVKKFMITGGNLPDSKDALHLAQTNDMFFSTVGCHPTRCDDFEKNNPDLYFVELLNLAENNKGKVVAIGECGLDFDRLQFCPKDTQLKYFEKQFELSEQTKLPMFLHCRNSHAEFLDIMKRNRDRCVGGVVHSFDGTKEAAAALIDLDLYIGFNGCSLKTEANLEVLKSIPSEKLMIETDAPWCGVKSTHAGSKYVKTSFPTKKKWENGHCLKDRNEPCHIIQILEIMSAVRDEDPVELANTLYNNTIKLFFPDM",
"proteome": "UP000504628",
"gene": "TATDN1",
"go_terms": [
{
"identifier": "GO:0016788",
"name": "hydrolase activity, acting on ester bonds",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "154145fa1dcb1229df6829a4777227af664ffb5c",
"counters": {
"domain_architectures": 58842,
"entries": 11,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"cdd": 1,
"ssf": 1,
"pfam": 1,
"pirsf": 1,
"panther": 1,
"prosite": 1,
"interpro": 4
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 58842
}
}
}