General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A6J2MUX8",
        "id": "A0A6J2MUX8_9CHIR",
        "source_organism": {
            "taxId": "89673",
            "scientificName": "Phyllostomus discolor",
            "fullName": "Phyllostomus discolor (pale spear-nosed bat)"
        },
        "name": "Anaphase-promoting complex subunit 5",
        "description": [
            "Component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin ligase that controls progression through mitosis and the G1 phase of the cell cycle. The APC/C complex acts by mediating ubiquitination and subsequent degradation of target proteins: it mainly mediates the formation of 'Lys-11'-linked polyubiquitin chains and, to a lower extent, the formation of 'Lys-48'- and 'Lys-63'-linked polyubiquitin chains. The APC/C complex catalyzes assembly of branched 'Lys-11'-/'Lys-48'-linked branched ubiquitin chains on target proteins"
        ],
        "length": 755,
        "sequence": "MASVHESLYFNPMMTNGVVHANVFGIKDWVTPYKIAVLVLLNEMGRTGEAAVSLLERRRLNQLLLPLLQGPDITLSKLYKLIEESCPQLANSVQIRIKLMAEGELKDMEQFFDDLSDSFSGTEPEVHKTSVVGLFLRHMILAYSKLSFSQVFKLYTALQQYFQNGEKKTVEDADMELAGREEGERKMEKEELDVSIREEEVSCSGPLSQKQAEFFLSQQASLLKNDETKALTPAALQKELNNLLKFNPDFAEAHYLSYLNNLRVQDVFSSTHSLLHYFDRLILTGAESKSNGEEGYGRSLRYAALNLAALHCRFGHYHQAELALQEAIRIAQESNDHVCLQHCLSWLYVLGQKRSDSYVLLEHSVKKAVHFGLPYLASLGIQSLVQQRAFAGKTAHKLMDALKDSDLLHWKHSLSELIDISIAQKTAIWRLYGRSTMALQQAQMLLSMNSLESVNAGVQQNNTESFAVALCHLAELHAEQGCFAAASEVLKHLKERFPPNSQHAQLWMLCDQKIQFDRAMHDGKYHLADSLVTGIAALHSMEGVYRKAVVLQAQNQMSEAHKLLQKLLLHCQKTRNTEMVISVLLCVAELYWRSSSPAVALPVLLQALALSKEYRLQYLASETVLNLAFAQLILGXPEQALSLLHMAIEPILADGAVLDXGRAMFLVAKCQVASAASYEPPKKAEALEAAIENLSEAKNYFSKVDCKERIRDVVYFQARLYHALGKTQERNRCAMLFRQLHQELPSHGVPLINHL",
        "proteome": "UP000504628",
        "gene": "ANAPC5",
        "go_terms": [
            {
                "identifier": "GO:0005515",
                "name": "protein binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0005680",
                "name": "anaphase-promoting complex",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": false,
        "in_bfvd": false,
        "ida_accession": "0a2ac6d29459db9b5315642be42f63f9424b09f6",
        "counters": {
            "domain_architectures": 632,
            "entries": 10,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 2,
                "cdd": 1,
                "cathgene3d": 1,
                "ssf": 1,
                "panther": 1,
                "interpro": 4
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 632
        }
    }
}