GET /api/protein/UniProt/A0A6J2MUX8/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A6J2MUX8",
"id": "A0A6J2MUX8_9CHIR",
"source_organism": {
"taxId": "89673",
"scientificName": "Phyllostomus discolor",
"fullName": "Phyllostomus discolor (pale spear-nosed bat)"
},
"name": "Anaphase-promoting complex subunit 5",
"description": [
"Component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin ligase that controls progression through mitosis and the G1 phase of the cell cycle. The APC/C complex acts by mediating ubiquitination and subsequent degradation of target proteins: it mainly mediates the formation of 'Lys-11'-linked polyubiquitin chains and, to a lower extent, the formation of 'Lys-48'- and 'Lys-63'-linked polyubiquitin chains. The APC/C complex catalyzes assembly of branched 'Lys-11'-/'Lys-48'-linked branched ubiquitin chains on target proteins"
],
"length": 755,
"sequence": "MASVHESLYFNPMMTNGVVHANVFGIKDWVTPYKIAVLVLLNEMGRTGEAAVSLLERRRLNQLLLPLLQGPDITLSKLYKLIEESCPQLANSVQIRIKLMAEGELKDMEQFFDDLSDSFSGTEPEVHKTSVVGLFLRHMILAYSKLSFSQVFKLYTALQQYFQNGEKKTVEDADMELAGREEGERKMEKEELDVSIREEEVSCSGPLSQKQAEFFLSQQASLLKNDETKALTPAALQKELNNLLKFNPDFAEAHYLSYLNNLRVQDVFSSTHSLLHYFDRLILTGAESKSNGEEGYGRSLRYAALNLAALHCRFGHYHQAELALQEAIRIAQESNDHVCLQHCLSWLYVLGQKRSDSYVLLEHSVKKAVHFGLPYLASLGIQSLVQQRAFAGKTAHKLMDALKDSDLLHWKHSLSELIDISIAQKTAIWRLYGRSTMALQQAQMLLSMNSLESVNAGVQQNNTESFAVALCHLAELHAEQGCFAAASEVLKHLKERFPPNSQHAQLWMLCDQKIQFDRAMHDGKYHLADSLVTGIAALHSMEGVYRKAVVLQAQNQMSEAHKLLQKLLLHCQKTRNTEMVISVLLCVAELYWRSSSPAVALPVLLQALALSKEYRLQYLASETVLNLAFAQLILGXPEQALSLLHMAIEPILADGAVLDXGRAMFLVAKCQVASAASYEPPKKAEALEAAIENLSEAKNYFSKVDCKERIRDVVYFQARLYHALGKTQERNRCAMLFRQLHQELPSHGVPLINHL",
"proteome": "UP000504628",
"gene": "ANAPC5",
"go_terms": [
{
"identifier": "GO:0005515",
"name": "protein binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0005680",
"name": "anaphase-promoting complex",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": false,
"in_bfvd": false,
"ida_accession": "0a2ac6d29459db9b5315642be42f63f9424b09f6",
"counters": {
"domain_architectures": 632,
"entries": 10,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"pfam": 2,
"cdd": 1,
"cathgene3d": 1,
"ssf": 1,
"panther": 1,
"interpro": 4
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 632
}
}
}