GET /api/protein/UniProt/A0A6J2JSP0/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A6J2JSP0",
        "id": "A0A6J2JSP0_BOMMA",
        "source_organism": {
            "taxId": "7092",
            "scientificName": "Bombyx mandarina",
            "fullName": "Bombyx mandarina (Wild silk moth)"
        },
        "name": "Uridine diphosphate glucose pyrophosphatase NUDT14",
        "description": [
            "Hydrolyzes UDP-glucose to glucose 1-phosphate and UMP and ADP-ribose to ribose 5-phosphate and AMP. The physiological substrate is probably UDP-glucose. Poor activity on other substrates such as ADP-glucose, CDP-glucose, GDP-glucose and GDP-mannose"
        ],
        "length": 211,
        "sequence": "MEDLKDVYLSPLPESPYVKPFRFNYTQNGKEKTWDLLEVHDSVAIIVFNVTRRVMIFVKQFRPAIYYNSITPEDRKASKIDTNKYPASLGIALEICAGIIDKNLPIEEIAKEEVLEECGYNVELSNLEKVIAYRSGVGVQGALQTMFYCEVTDDMKTEQGGGVDDEIIEVIEKTIPEVEEMLRSQDILSSPPSCLFALMWFIHNKADKFRK",
        "proteome": "UP000504629",
        "gene": "LOC114243825",
        "go_terms": [
            {
                "identifier": "GO:0016818",
                "name": "hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0046872",
                "name": "metal ion binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 4,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": null,
        "counters": {
            "domain_architectures": 0,
            "entries": 9,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "cdd": 1,
                "profile": 1,
                "cathgene3d": 1,
                "ncbifam": 1,
                "panther": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1
        }
    }
}