HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A6J2J259",
"id": "A0A6J2J259_9PASS",
"source_organism": {
"taxId": "649802",
"scientificName": "Pipra filicauda",
"fullName": "Pipra filicauda (Wire-tailed manakin)"
},
"name": "E3 ubiquitin-protein ligase",
"description": [
"Ubiquitin ligase protein which is a component of the N-end rule pathway. Recognizes and binds to proteins bearing specific N-terminal residues that are destabilizing according to the N-end rule, leading to their ubiquitination and subsequent degradation"
],
"length": 525,
"sequence": "MAAELEAEVQAIDKSLLECSAEEIAVKWLQANDLQKEVYQHLAYYVPKIYCRGPNPAPQREDMLAQHVLLGPMEWYLCGEDPAFGFPKLEQANKPSHLCGRVFKVGEPTYSCRDCAVDPTCVLCMECFLGSIHREHRYRMTTSGGGGFCDCGDTEAWKEGPYCQKHELNTSETAEEEDPLVHLPEDMVARAYNIFAITFKYAVDILTWEKENELPGLEMTEKSDTYYCMLFNDEVHTYEQVIYTLQKAVNCTQKEAIGFATTVDRDGRRSVRYGDFQYCDQAKSVIVRNTSRQTKPLKVQVMHSSIVAHQSFGLKLLTWLGSVIGYSDGLRRILCQVGLQEGPDGENSSLVDKLMLYDSKLWKGARSVYHQLFMSSLLMDLKYKKLFAIRFARNYERLQSDFMKDDHDREFSIADLSIQIFTVPSLARMLITEENLMTTIIKTFMDHLRHRDIQGRFQFERYTALQAFKFRRVQSLILDLKYVLISKPTEWSDDLRRKFLEGFDAFLELLKCMQPFHVLILGGAF",
"proteome": "UP000504627",
"gene": "UBR2",
"go_terms": [
{
"identifier": "GO:0008270",
"name": "zinc ion binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0061630",
"name": "ubiquitin protein ligase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0071596",
"name": "ubiquitin-dependent protein catabolic process via the N-end rule pathway",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0030163",
"name": "protein catabolic process",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "260e8c466a89b86ddaaaa904aee849e7a414a129",
"counters": {
"domain_architectures": 208,
"entries": 14,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"smart": 1,
"profile": 1,
"cdd": 1,
"cathgene3d": 2,
"ssf": 1,
"panther": 1,
"pfam": 2,
"interpro": 5
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 208
}
}
}