GET /api/protein/UniProt/A0A6J2J259/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A6J2J259",
        "id": "A0A6J2J259_9PASS",
        "source_organism": {
            "taxId": "649802",
            "scientificName": "Pipra filicauda",
            "fullName": "Pipra filicauda (Wire-tailed manakin)"
        },
        "name": "E3 ubiquitin-protein ligase",
        "description": [
            "Ubiquitin ligase protein which is a component of the N-end rule pathway. Recognizes and binds to proteins bearing specific N-terminal residues that are destabilizing according to the N-end rule, leading to their ubiquitination and subsequent degradation"
        ],
        "length": 525,
        "sequence": "MAAELEAEVQAIDKSLLECSAEEIAVKWLQANDLQKEVYQHLAYYVPKIYCRGPNPAPQREDMLAQHVLLGPMEWYLCGEDPAFGFPKLEQANKPSHLCGRVFKVGEPTYSCRDCAVDPTCVLCMECFLGSIHREHRYRMTTSGGGGFCDCGDTEAWKEGPYCQKHELNTSETAEEEDPLVHLPEDMVARAYNIFAITFKYAVDILTWEKENELPGLEMTEKSDTYYCMLFNDEVHTYEQVIYTLQKAVNCTQKEAIGFATTVDRDGRRSVRYGDFQYCDQAKSVIVRNTSRQTKPLKVQVMHSSIVAHQSFGLKLLTWLGSVIGYSDGLRRILCQVGLQEGPDGENSSLVDKLMLYDSKLWKGARSVYHQLFMSSLLMDLKYKKLFAIRFARNYERLQSDFMKDDHDREFSIADLSIQIFTVPSLARMLITEENLMTTIIKTFMDHLRHRDIQGRFQFERYTALQAFKFRRVQSLILDLKYVLISKPTEWSDDLRRKFLEGFDAFLELLKCMQPFHVLILGGAF",
        "proteome": "UP000504627",
        "gene": "UBR2",
        "go_terms": [
            {
                "identifier": "GO:0008270",
                "name": "zinc ion binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0061630",
                "name": "ubiquitin protein ligase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0071596",
                "name": "ubiquitin-dependent protein catabolic process via the N-end rule pathway",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0030163",
                "name": "protein catabolic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "260e8c466a89b86ddaaaa904aee849e7a414a129",
        "counters": {
            "domain_architectures": 208,
            "entries": 14,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "smart": 1,
                "profile": 1,
                "cdd": 1,
                "cathgene3d": 2,
                "ssf": 1,
                "panther": 1,
                "pfam": 2,
                "interpro": 5
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 208
        }
    }
}