HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A6J2GV32",
"id": "A0A6J2GV32_9PASS",
"source_organism": {
"taxId": "649802",
"scientificName": "Pipra filicauda",
"fullName": "Pipra filicauda (Wire-tailed manakin)"
},
"name": "Vacuolar protein-sorting-associated protein 36",
"description": [
"Component of the ESCRT-II complex (endosomal sorting complex required for transport II), which is required for multivesicular body (MVB) formation and sorting of endosomal cargo proteins into MVBs"
],
"length": 386,
"sequence": "MDRFSWTTGLLELGETLVVQQRGVRLSDGEEKVKFDSGVLLLSTHRLIWRDQKNHECCIAVPLSQIVFIEEQSSGIGKSAKIVVHLHPASSNKEPGPFQSSKYSYIKLSFKEHGQIEFYRRLSEEMTQRRWESMPTGQAMQVNKDTQAGRIRAVGIVGIERKIEEKRKETDKNISEAFEDLSKLMEKAKEMVELSKSIANKIKEKQGDITEDETIRFKSYLLSMGIANPVTRETYGSGTQYHMQLAKQLAGILQTPLEERGGIMSLTEVYCLVNRARGLELLSPEDLVNACKMLESLKLPIRLRIFDSGVMVIELQSHNEEEMVASALETVSEKGSLTADEFAKLVGMSVLLAKERLLLAEKMGHLCRDDSVEGLRFYPNLFLTQS",
"proteome": "UP000504627",
"gene": "VPS36",
"go_terms": [
{
"identifier": "GO:0032266",
"name": "phosphatidylinositol-3-phosphate binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0043130",
"name": "ubiquitin binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0032509",
"name": "endosome transport via multivesicular body sorting pathway",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0000814",
"name": "ESCRT II complex",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "6af842596849133deb280acbb1887a3fa7a82d1f",
"counters": {
"domain_architectures": 2387,
"entries": 16,
"isoforms": 0,
"proteomes": 1,
"sets": 3,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cdd": 1,
"profile": 1,
"cathgene3d": 3,
"pfam": 2,
"ssf": 2,
"panther": 1,
"interpro": 6
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 2387
}
}
}