General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A6J2GV32",
        "id": "A0A6J2GV32_9PASS",
        "source_organism": {
            "taxId": "649802",
            "scientificName": "Pipra filicauda",
            "fullName": "Pipra filicauda (Wire-tailed manakin)"
        },
        "name": "Vacuolar protein-sorting-associated protein 36",
        "description": [
            "Component of the ESCRT-II complex (endosomal sorting complex required for transport II), which is required for multivesicular body (MVB) formation and sorting of endosomal cargo proteins into MVBs"
        ],
        "length": 386,
        "sequence": "MDRFSWTTGLLELGETLVVQQRGVRLSDGEEKVKFDSGVLLLSTHRLIWRDQKNHECCIAVPLSQIVFIEEQSSGIGKSAKIVVHLHPASSNKEPGPFQSSKYSYIKLSFKEHGQIEFYRRLSEEMTQRRWESMPTGQAMQVNKDTQAGRIRAVGIVGIERKIEEKRKETDKNISEAFEDLSKLMEKAKEMVELSKSIANKIKEKQGDITEDETIRFKSYLLSMGIANPVTRETYGSGTQYHMQLAKQLAGILQTPLEERGGIMSLTEVYCLVNRARGLELLSPEDLVNACKMLESLKLPIRLRIFDSGVMVIELQSHNEEEMVASALETVSEKGSLTADEFAKLVGMSVLLAKERLLLAEKMGHLCRDDSVEGLRFYPNLFLTQS",
        "proteome": "UP000504627",
        "gene": "VPS36",
        "go_terms": [
            {
                "identifier": "GO:0032266",
                "name": "phosphatidylinositol-3-phosphate binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0043130",
                "name": "ubiquitin binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0032509",
                "name": "endosome transport via multivesicular body sorting pathway",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0000814",
                "name": "ESCRT II complex",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "6af842596849133deb280acbb1887a3fa7a82d1f",
        "counters": {
            "domain_architectures": 2387,
            "entries": 16,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 3,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cdd": 1,
                "profile": 1,
                "cathgene3d": 3,
                "pfam": 2,
                "ssf": 2,
                "panther": 1,
                "interpro": 6
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 2387
        }
    }
}