General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A6J2F5D1",
        "id": "A0A6J2F5D1_ZALCA",
        "source_organism": {
            "taxId": "9704",
            "scientificName": "Zalophus californianus",
            "fullName": "Zalophus californianus (California sealion)"
        },
        "name": "N-terminal EF-hand calcium-binding protein 2",
        "description": [
            "May act as a signaling scaffold protein that senses intracellular calcium. Can modulate ligand-induced internalization of ADORA2A and coupling efficiency of mGluR5/GRM5; for both receptors may regulate signaling activity such as promoting MAPK1/3 (ERK1/2) activation"
        ],
        "length": 406,
        "sequence": "MCERAARLCRAGAHRLLREPPPQSRALGGLLRWVGARMGEPRAPLAPDAHDAPAADPSPGPGPGSPRGGTAVILDIFRRADKNDDGKLSLEEFQLFFADGVLNEKELEDLFHTIDSDNTNHVDTKELCDYFVDHMGDYEDVLASLETLNHSVLKAMGYTKKVYEGGSNVDQFVTRFLLKETANQIQSLLSSVESAVEAIEEQTSQIRQNHSKPSHGVVETWSGSAAPPHAPNPKLGASEQGKSLPSGTVDPKEEGLEAQISRLAELIGRLESKTLWFDLQQRLSDEEGTNMHLQLVRQEMAVCPEQLSEFVDSLRQYLRGTAGARNCFHIAAVRLADGFTFVVYEFWETEEEWRRHLLSPVCKAFRHVKVDTLSQPEALSRILVPETLVYKLSFQYTSGQECIFPV",
        "proteome": "UP000515165",
        "gene": "NECAB2",
        "go_terms": [
            {
                "identifier": "GO:0005509",
                "name": "calcium ion binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 4,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "79d8bdb9c2e4a5d6ae040c73a18a023bbf38eeda",
        "counters": {
            "domain_architectures": 438,
            "entries": 18,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 3,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "profile": 2,
                "ssf": 2,
                "smart": 1,
                "pfam": 2,
                "cdd": 1,
                "panther": 1,
                "prosite": 1,
                "interpro": 6
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 438
        }
    }
}