GET /api/protein/UniProt/A0A6J2EVM8/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A6J2EVM8",
"id": "A0A6J2EVM8_ZALCA",
"source_organism": {
"taxId": "9704",
"scientificName": "Zalophus californianus",
"fullName": "Zalophus californianus (California sealion)"
},
"name": "Phosphomevalonate kinase",
"description": [
"Catalyzes the reversible ATP-dependent phosphorylation of mevalonate 5-phosphate to produce mevalonate diphosphate and ADP, a key step in the mevalonic acid mediated biosynthesis of isopentenyl diphosphate and other polyisoprenoid metabolites"
],
"length": 192,
"sequence": "MASPGGVPRLVLLVSGKRKSGKDFVAEALRSRLGADVCAILRLSSPLKERYAQENGLDFQRLLDASVYKETYRRDMIRWGEEKRQADPGCFCRKVVEGVSQPVWLVSDTRRASDIQWFREAYGAVTQTVRVVALEQSRQQRGWVFTAGVDDAESECGLDNFGAFDWVIENHGDEQHLEEQLEGLVAFVHSRL",
"proteome": "UP000515165",
"gene": "PMVK",
"go_terms": [
{
"identifier": "GO:0004631",
"name": "phosphomevalonate kinase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006695",
"name": "cholesterol biosynthetic process",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0005737",
"name": "cytoplasm",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 4,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "96ce6af7f6af2a6ab14f7527c543c2db714f9843",
"counters": {
"domain_architectures": 1568,
"entries": 8,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"panther": 1,
"pirsf": 1,
"ncbifam": 1,
"pfam": 1,
"interpro": 2
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 1568
}
}
}